Protein Info for Shew_0625 in Shewanella loihica PV-4

Annotation: spermidine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details PF01564: Spermine_synth" amino acids 314 to 507 (194 residues), 116 bits, see alignment E=7.9e-38

Best Hits

Swiss-Prot: 79% identical to SPEE_SHEON: Polyamine aminopropyltransferase (speE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to slo:Shew_0625)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAJ9 at UniProt or InterPro

Protein Sequence (575 amino acids)

>Shew_0625 spermidine synthase (RefSeq) (Shewanella loihica PV-4)
MQSTHTTTPAPAGVKSLSWFDDLLLLGIMAVLAACGLIYEYLLSHYAGRILGALEAAIYT
MIGLMIVSMGVGAFAARKIRCAFTGFAMLELCVALCGALAILITAAVIGFGQQLPIIIAS
TIGLPPDQLPQGGFIGTLQKLSEYLPYAWGVLLGLMIGMEIPLIARVRQSLCDEHLMHNA
GTIYGADYIGAGVGAAIWVIFMLALDIQLAAALTASFNLLAGFLFIWRFWSKIRFNRLLL
AGHLLATGILLVLAIHGPKWDQAFNNLLYKDKVVYAKATRFQQLTFTERLRGNHLAPVYS
LYINGRLQFSSQDEHIYHAFLVHPTLAASARHDKVLIIGGGDGLGLRQVLKWQPKQVTLM
DLDADLVRLFKEGDPEMPPRLSNALLKLNGDAFNDARVELLIDDAFNGADKLIRRGEKFD
AIIVDLPDPSHPDLNKLYSDLFYRKLKELLSSDGAISVQSTSPYHAAKAFISVGKTLQAA
SFQVEQYHHNVPSFGEWGWSIGTLRGQNAKQRLSSMTELPVDDPWLTPGLIRAAFEFPKN
YYEHADQVKVNDIGSMHLYRYHQRAWSEDENLTLD