Protein Info for Shew_0613 in Shewanella loihica PV-4

Annotation: cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 23 to 556 (534 residues), 596 bits, see alignment E=4.2e-183 PF00664: ABC_membrane" amino acids 26 to 292 (267 residues), 139.2 bits, see alignment E=2.3e-44 PF00005: ABC_tran" amino acids 370 to 514 (145 residues), 93.6 bits, see alignment E=1.7e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0613)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAI7 at UniProt or InterPro

Protein Sequence (587 amino acids)

>Shew_0613 cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq) (Shewanella loihica PV-4)
MDKTLEKVLGRWLKQQKSACGAYLNLTVLIGVLTGFALVAQAYLLATMLHGLIIENLPRE
AFTSEFIALIAVIVLRAALAYGRERISFKAGMLLRSQIRQSVLDKLVELGPVFIKGRPAG
SWASIVLEQVEDLHDFYAKYLPQMMLAGFIPLTILAVVFPINWAAGIILLATAPLIPLFM
ILVGMGAADANRKNFGALSRLSGHFMDRLRGIGTLRLFHAGEREQQAIESASEEFRSRTM
AVLRMAFLSSAVLEFFAAVSIAVLAVYFGFSFLDHLDFGHYGAGMTLFIGLFVLILAPEF
YQPLRDMGTHYHAKAQAIGAAEALMELLNHQGDEADEAPRVPFTSETPLSIKLQGAEVLS
PDGQVLLGPITAEVIGGEQLAIVGPSGAGKTSLLNMLLGFLSYRGSVLINGVELSSLERE
SYRHHLAWLGQEPQLFHGTIGDNVAMGKEMSDEAIYTLLDDARIGDFVRAQPLGLAHPIG
EQSAGVSVGQAQRLCLARALGQSAKLFVLDEPTASLDSHSEAAVMQALIDVRQGATSLLV
THRLDALIDMDKIWVLDGGKLVQQGDYHTLMAEPGLFSDLCHRQEEA