Protein Info for Shew_0597 in Shewanella loihica PV-4

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 334 (301 residues), 51.9 bits, see alignment E=6e-18 PF00854: PTR2" amino acids 251 to 405 (155 residues), 31.7 bits, see alignment E=7.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0597)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAH1 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Shew_0597 major facilitator transporter (RefSeq) (Shewanella loihica PV-4)
MPGRLKMNNNSKSTEAPRFPRIFWIANGVELLERAAYYGVFIVITLYLSRILGFSDVEAA
WLAGSFSAGLYFLPTFSGALADKIGFRGALLLAFGLLTIGYASLAIFPALIESQGLVEYG
KETIYHGLKEADIRWAIVPILIVIMIGGSFIKAVITGTVALSTTAETRAKGFSIFYMMVN
IGAFSGKTVVKPLRESMGDLGLINLNYFAATMTLIAFFSIMLFFKSTEENRSGKSLGEIW
QALLKVLSNGRLIALILIITGFWMVQHQLYATMPKYVLRMAGEGSSPSWYANVNPLVVFL
CVSFVTGMMAKRSALTSMTVGMFIMPVSALLMASGNMFAGSETILGMHPIAAMMIIGIVF
QGLAECFISPRFLEYFSLQAPKGEEGLYLGFSHLHSFISSLLGFGLSGYLLEAYCPDPRV
YNDHAAWVEASAHAHYIWYVFAAIASVSAVSLIIYGAVIKRIDAKNDTDAEMATA