Protein Info for Shew_0576 in Shewanella loihica PV-4

Annotation: peptidase S9 prolyl oligopeptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00930: DPPIV_N" amino acids 379 to 539 (161 residues), 74.1 bits, see alignment E=2.3e-24 PF02129: Peptidase_S15" amino acids 585 to 729 (145 residues), 46.2 bits, see alignment E=1.2e-15 PF20434: BD-FAE" amino acids 596 to 708 (113 residues), 37.4 bits, see alignment E=5e-13 PF00326: Peptidase_S9" amino acids 632 to 827 (196 residues), 166.5 bits, see alignment E=1.5e-52 PF01738: DLH" amino acids 633 to 811 (179 residues), 25.4 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0576)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAF0 at UniProt or InterPro

Protein Sequence (828 amino acids)

>Shew_0576 peptidase S9 prolyl oligopeptidase (RefSeq) (Shewanella loihica PV-4)
MTGAFRGFGLSILTLTILGGCAATPSSDTQQTQVTTQASTQVALATPPSVDQPLTLKQIM
ANPDWMGILAKGEYWSDDSQSVYFARQAHQSPLLDYYQQPLVSGEAAKLALDALHQADQQ
YGVMDEARSRKAYIYQGNLFVKDLLSGKVSQLTRQNTKVDGVRFLTNGDIAYWQGEQVFR
IHGDSGLYEQIANIKMVKQPKGVEAPSSYIAKQQHRLIEYVALKQNQAKEKEQYQVELAK
QDPTMTAKTWYLGDEETVSQMSLSPDGRYLLLSLVDKNYSWRAEHDIMPNYLGSQGYVDA
VPARARVAEDKYPGERLVLLDLEQHEKRDITIEGLTGFDEDVLASVKAENAKAKGETYKS
EKSPRKVQLMQDWGWTQSAMQWQAKDNKVAIMLEAVDNKDRWIATLNLKSGSLKTEHRLH
DDAWVNYNFNQFGWLPQSDTLYYLSEETGYSHLYLKASGAKPQALTQGKYVVSDITLGPK
AEYIYYKANKDHPGIDNVYRVNIADGQSEQLTQWDGQLDYSLSPDGSKLLLKASRRTQPS
ELYVQAIGGELKQLTHYTSDAFKQYAWQAPEVVKVPSTHGAGDVYARVYLPQGFDKARAD
KYPAVIFNHGAGYLQNAHYGFSGYFREFMFHNLLTQQGYVVMDMDYRGSKGYGRDWRTAI
YRNMGHPEVEDLKDGVNWMVANTHVDLKRVGTYGGSYGGFLTFMALFTEPELFQAGAALR
PVSDWAHYNAPYTSNILNTPDVDAIAYERSSPIEHAQGLQKPLLVMSGVLDDNVFFQDSV
RLVQRLIELEKPMFETAIYPVEPHGFRQPSSWLDEYRRIFKLFEQELK