Protein Info for Shew_0571 in Shewanella loihica PV-4

Annotation: cytochrome b/b6 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details PF00033: Cytochrome_B" amino acids 26 to 212 (187 residues), 219.8 bits, see alignment E=4.5e-69 PF13631: Cytochrom_B_N_2" amino acids 94 to 264 (171 residues), 150.2 bits, see alignment E=8.3e-48 PF00032: Cytochrom_B_C" amino acids 279 to 380 (102 residues), 138.4 bits, see alignment E=1.4e-44

Best Hits

Swiss-Prot: 63% identical to CYB_ALLVD: Cytochrome b (petB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 100% identity to slo:Shew_0571)

MetaCyc: 48% identical to cytochrome b (Acidithiobacillus ferrooxidans)
RXN-15829 [EC: 7.1.1.8]

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2 or 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAE5 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Shew_0571 cytochrome b/b6 domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MVKNIIDWIDARIPMTATYNRHVGQYATPTNFNFWYFFGSLAMLVLVNQLLTGIWLTMNY
VPTAEGAFASIEYIMRDVEYGWLLRYMHSTGASAFFVVVYLHMFRGLIYGSYQKPRELLW
LFGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGDDLTLWIRGDFVVSGA
TLNRFFALHVIALPLVLVVLVFLHLIALHEVGSNNPDGIEIKKNKDENGWPKDGIPFHPY
YTVKDIMGVAGFLIVFCYVLFFMPEGGGYFLEKPNFEAANPMKTPEHIAPVWYFTPFYAI
LRAIPDKLLGVVGMGLAIAVLFVLPWLDRCKVKSIRYRSMIHKLNIGQFAVSFVILGYLG
AVPATPTLTIAARVFTLTYFGFFLALWLYSKNEKTKPVPERLTH