Protein Info for Shew_0562 in Shewanella loihica PV-4
Annotation: hypothetical protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to TSAE_ECOLI: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Escherichia coli (strain K12)
KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 100% identity to slo:Shew_0562)MetaCyc: 62% identical to N6-L-threonylcarbamoyladenine synthase, TsaE subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]
Predicted SEED Role
"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"
MetaCyc Pathways
- N6-L-threonylcarbamoyladenosine37-modified tRNA biosynthesis (2/2 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.234
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QAD6 at UniProt or InterPro
Protein Sequence (157 amino acids)
>Shew_0562 hypothetical protein (RefSeq) (Shewanella loihica PV-4) MTPVKVYLENEAETVSLGQRLASAIKPPLTLYLSGELGAGKTTFSRGLIQSLGHKGAVKS PTYTLVEPYELGDIDVYHFDLYRLSDPEELEFMGIRDYFTESSLCIVEWPDKGVGLLPEA DLAIHIQYHQQGREVMLTAHSRAGEILLDSLHNNDKN