Protein Info for Shew_0561 in Shewanella loihica PV-4

Annotation: carbohydrate kinase, YjeF-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 TIGR00197: YjeF family N-terminal domain" amino acids 32 to 213 (182 residues), 129.4 bits, see alignment E=1.4e-41 PF03853: YjeF_N" amino acids 35 to 192 (158 residues), 129.6 bits, see alignment E=1.2e-41 TIGR00196: YjeF family C-terminal domain" amino acids 231 to 489 (259 residues), 222.2 bits, see alignment E=8.5e-70 PF01256: Carb_kinase" amino acids 248 to 485 (238 residues), 197.1 bits, see alignment E=3.3e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0561)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAD5 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Shew_0561 carbohydrate kinase, YjeF-related protein (RefSeq) (Shewanella loihica PV-4)
MLFSDGQLPSALYTAQMIRDAEARLIASGEANLCQLIDSAGQSAFELLQREGKLNSKILV
LAGYGNNGADAYICATLLLESGCDVALYAVERSEAGEGISYAKAAFLAAGGHQLSDYEEA
LKEAEVVVDGLLGTGVKGELRAPFAEMIVAINRYSPWILSLDVPSGIDVDTGAGQLAVKA
DVTLTFGAPKQGLITGKARDCVGRLWFADIGLQEYLPESKVLNIAHRLTDLGLPARAQNS
HKGACGKVTVIGGDIGMAGAPRLAAESCLRAGAGLVAVISRPEHLTVVNSGRPEIMFWGC
ELVDMEVYQRLGWADILLIGPGLGKHDWGYNLLKATGLSDKSCVMDADALNLLALEPSRQ
SNWVLTPHSGEAARLLGISIAEVEADRFAAVYALQAKYGGVVVLKGAGTLIYDGKVCHVA
PVGNPGLASGGSGDVLGGIIAALMAQGMAKMEAASAGVVVHGAAADLAAKDGERGMLACD
LFAHIRALVDKI