Protein Info for Shew_0557 in Shewanella loihica PV-4

Annotation: phosphatidylserine decarboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF27523: PSD" amino acids 4 to 45 (42 residues), 70.5 bits, see alignment 7.6e-24 TIGR00163: phosphatidylserine decarboxylase" amino acids 48 to 284 (237 residues), 255.2 bits, see alignment E=2.3e-80 PF02666: PS_Dcarbxylase" amino acids 62 to 283 (222 residues), 219.5 bits, see alignment E=3.6e-69

Best Hits

Swiss-Prot: 100% identical to PSD_SHELP: Phosphatidylserine decarboxylase proenzyme (psd) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to slo:Shew_0557)

MetaCyc: 54% identical to phosphatidylserine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAD1 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Shew_0557 phosphatidylserine decarboxylase (RefSeq) (Shewanella loihica PV-4)
MDKLKIALQYIMPKHLLSRLVGKLAAAELGAVTTSVIKWFIKQYKIDMSEAAQSAPEAYA
SFNQFFTRALKPGIRPLCDDDDYIVHPVDGAVSQCGPIKEGRIFQAKGHEYSSLALLGDQ
ADDAKRFEGGDFATIYLAPKDYHRIHMPIKGTLSKMTYVPGELFSVNPLTAENVPGLFAR
NERVVAIFETEIGPMAMVLVGATIVASIETVWAGTVTPPTGKKVFTWDYPTEGPEAITLD
KGEEMGRFKLGSTVVMLFAKDALEHFADGVEPKAVTRMGQAFAKID