Protein Info for Shew_0549 in Shewanella loihica PV-4

Annotation: DNA topoisomerase IV subunit B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 TIGR01055: DNA topoisomerase IV, B subunit" amino acids 3 to 625 (623 residues), 1057.8 bits, see alignment E=0 PF02518: HATPase_c" amino acids 28 to 168 (141 residues), 54.9 bits, see alignment E=2.3e-18 PF00204: DNA_gyraseB" amino acids 218 to 385 (168 residues), 142.6 bits, see alignment E=1.8e-45 PF01751: Toprim" amino acids 413 to 522 (110 residues), 48.8 bits, see alignment E=1.3e-16 PF00986: DNA_gyraseB_C" amino acids 557 to 620 (64 residues), 85 bits, see alignment E=6.3e-28

Best Hits

Swiss-Prot: 74% identical to PARE_SALTY: DNA topoisomerase 4 subunit B (parE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 100% identity to slo:Shew_0549)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAC3 at UniProt or InterPro

Protein Sequence (628 amino acids)

>Shew_0549 DNA topoisomerase IV subunit B (RefSeq) (Shewanella loihica PV-4)
MTNQYTSDAIEVLNGLDPVKRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHATRIDVILH
KDNSLEVIDDGRGMPVDIHPEEGIPGVELILTKLHAGGKFSNNNYQFSGGLHGVGISVVN
ALSNRVEITVRRSGQVYEMAFEHGDKVEELTVTGTCGRRNTGTRVHFWPTASYFDSVNFS
IPKLIYLLRAKAVLCPGLRIKFTNKQTGDVEEWCYESGLTDYLKSSTQGALTLPEEPFIG
SMAGNTEAVDWAITWLPEGGDSLNESYVNLIPTPLGGTHVNGFRQGLLEAMREFCEFRNL
IPRGIKLSPEDIWDRSSFILSIKMQDPQFAGQTKEKLSSRQSAAFVSGIVRDAFSLWLNT
HTDQAEALAEMCISNAQKRLKAAKKVARKKVTSGPALPGKLTDCSGQDPMRGELFLVEGD
SAGGSAKQARDREFQAIMPLRGKILNTWEVEASQVLASQEVHDISVAIGCDPDSNDISEL
RYGKICILADADSDGLHIATLLCALFMKHYKVLVEKGHIYVAMPPLFRVDVGKEVYYALD
EAEKQGILDRISAEKKKGKVQVTRFKGLGEMNPLQLRETTMDPNTRRLVQLTIDDAEDTL
AIMDMLLAKKRSGDRKTWLETKGDLAQL