Protein Info for Shew_0517 in Shewanella loihica PV-4

Annotation: putative plasmid transfer protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13729: TraF_2" amino acids 47 to 316 (270 residues), 239.2 bits, see alignment E=2.5e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0517)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA91 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Shew_0517 putative plasmid transfer protein (RefSeq) (Shewanella loihica PV-4)
MKYLSLVIAVLLSGSASLASAASLYNEARSDAMGGTGVAASNREGAAFINPALLAIHAPK
YSGGAVMLPVLGAEAANIDNLTDKFDALQASYDGLEAAINASDVTGITNYRDMLVADLKS
LDGENAYGSVGLGFSVVLPTKRMPMSIFYKTYIDAVSVAVIEDSDIDALTNLDPNNPPAV
TDLDSQGAVVAGAISDLGVALSFPLSIVNMPVAVGISPKLQRIDTYNYVVSANNFDADDF
DDNKYRNDDTVANLDIGVAIQPLERMTIGLSGRNLVSQKLDTVEAMGRKFTYRVEALYTL
GVAYDWDNFSLTTDVDLNGHKRFDEIGETQYWRLGGEMRATDWLALRVGYRHDMKDTSSN
LYTLGTGFTIGRSFNLDLTGLVGTDDAVGGVIQTSYHF