Protein Info for Shew_0512 in Shewanella loihica PV-4

Annotation: ABC transporter-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 143 to 164 (22 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 265 to 292 (28 residues), see Phobius details amino acids 359 to 384 (26 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 144 to 400 (257 residues), 42 bits, see alignment E=1.4e-14 PF00005: ABC_tran" amino acids 470 to 620 (151 residues), 76.4 bits, see alignment E=5.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0512)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA86 at UniProt or InterPro

Protein Sequence (699 amino acids)

>Shew_0512 ABC transporter-related protein (RefSeq) (Shewanella loihica PV-4)
MNQHLDPIHLPKSLLIALFHQLGLSVQASNIDKSDLHDRLTHLEAYILLKKHHVGIKVQA
LDANLLVHSVYPFILLPQDGEPMVARRSNHSFQYLSKDNQWLTLDKLPGAGHVFLVESLP
AQSRSSSVFASHLAKLRPWYRPIFWLSLLSSLSGLAIPLFTMAVYDRVIGGQAPQILPSI
ALGAALALGIFVASRLLRAQALANVSNRFARDLSGITFNRLLSMPLSLLSRVGLSSHIAR
MRNAEKVRSLVAGPGGGGLIDLPFTLIALVAITLLSGVLVLVPLGMLLLFYLVMKALDKF
TQAAAPTISGEYQNSLNELSTHLLPLKSAGESGAWYEQFMRRAREHCRQNFLYSKRAGLN
AAVAHAMGLFTALATVFTGIFLVLNQSITPGALIACVMLIWRITGPAQLAFASRQKFTLL
KGAVDQFDRFMGVTTEFNELRLDSPNLNQTPALSFKHVTLRYSADSEPALSGVTLDIETG
ETVAIIGPNGSGKTSLLLTAIGVIEPQAGFVTVNGKNLKQFDPEIFRQWAAYSPTNSEIL
PGTLADNLRLAKPEASDEELKQALTDAGGASLLQALKQNIDANLFSRGTSMFSAVESSYI
SLARALLKGSPLLVMDEPIANRNPFARQAFIQTLKRLKGKTTILFTTHDQALIQQADKVV
ILDKGTVVYAGPLPNQDGVTTQGATNQDSTPSMEASQNE