Protein Info for Shew_0508 in Shewanella loihica PV-4

Annotation: xanthine/uracil/vitamin C permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 44 to 61 (18 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 345 to 370 (26 residues), see Phobius details PF16983: MFS_MOT1" amino acids 16 to 130 (115 residues), 73.6 bits, see alignment E=1.9e-24 amino acids 207 to 331 (125 residues), 99.5 bits, see alignment E=1.6e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0508)

Predicted SEED Role

"Probable sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA82 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Shew_0508 xanthine/uracil/vitamin C permease (RefSeq) (Shewanella loihica PV-4)
MRCNTQDVNQLNKHIGEFSGAFADLGTFLPLVLGLIAINHFSPQGIFLGFGLFALFTAYF
YRRPIPVQPMKVIAALVIAQGLTPGMLQASGILMGLILLLLAYSGAIGWMAKQLSPTVSI
GIQLAIGLQLIWMGGQMMSGTWLIGILAFSALFMSRFMPLPYLAMPLVLVLGMLWQANQG
SAPSFTLSATTDWQLGWPNIDEWQSAALLLVLPQLALTLTNAVIATSAMAGEKFPQDALV
DDKRFAPRRLATSSGWANLLLAPLGATPMCHGAGGLAVQYHFGARSWRAPALFGICCLLV
ALCWGDTIAQVLSLIPLAILGSLLAIAGLQLAWSKRFLDGKPFCIFVILSTAAVCLTINT
AAGLAVGVILEMGRRQWHLISDLRH