Protein Info for Shew_0498 in Shewanella loihica PV-4
Annotation: flavoprotein oxygenase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 33% identical to Y2278_BACHD: Uncharacterized protein BH2278 (BH2278) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
KEGG orthology group: None (inferred from 100% identity to slo:Shew_0498)Predicted SEED Role
"Flavin reductase-like, FMN-binding domain protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QA72 at UniProt or InterPro
Protein Sequence (209 amino acids)
>Shew_0498 flavoprotein oxygenase (RefSeq) (Shewanella loihica PV-4) MDTQARYYYEPSKGHGLAHDPLNAIVGPRPIGWIASRSPEGHRNLAPYSFFNCFNYHPPI IGFASVGYKDSLANILATGEFVWNLATRPLAEKMNLTSAALPAGSDEFDFAGLTPVAGSV VGVDRVAESPVNFECRLTQSLQLQSAAGDKIETWLVLGEVVAVHIDPSLIEDGSYQTAKA KPILRAGGPSAYYGISEALRFDMQRPQVP