Protein Info for Shew_0496 in Shewanella loihica PV-4

Annotation: amino acid carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 420 to 443 (24 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 15 to 439 (425 residues), 502.7 bits, see alignment E=4.1e-155 PF01235: Na_Ala_symp" amino acids 53 to 449 (397 residues), 459.9 bits, see alignment E=4.6e-142

Best Hits

Swiss-Prot: 62% identical to Y883_HAEIN: Uncharacterized transporter HI_0883 (HI_0883) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to slo:Shew_0496)

Predicted SEED Role

"Sodium/glycine symporter GlyP" in subsystem Glycine cleavage system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA70 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Shew_0496 amino acid carrier protein (RefSeq) (Shewanella loihica PV-4)
MNFHALLSEINAIVWGPITLCLLVGTGLYLTLRLRLIQVFKLPLALRLLFKPASGQGDLS
SFAALCTALSATIGTGNIVGVATAIKVGGPGALFWMWLAAFFGMATKYGECMLALKYRTT
DARGNIAGGPMYYIERGLGLGWLAKLFALFGVGVAFFGIGTFAQVNAISDAMTIAFHVPA
WVTALVLTLLVAAVTLGGVKRIAKVAQKLVPSMALGYVLACLWILVTFSEQIIPALQLVI
HSAFSPISAAGGFLGATVAQAIQIGIARGVFSNESGLGSAPIAAAAAKTKEPVEQGLVSM
TGTFFDTLLICTITGLVLIITGVWSGDAAGAAMTSAAFATGGSAVIGQYLVTIALVCFAF
TTILGWHYYGERCWYYLTGHKLGERGIKIYQFIFLSLIAVGAFIQLDLIWLLADTVNGLM
AIPNLIALIGLRKVIIADTLSYFAARDSQGAQQELTA