Protein Info for Shew_0471 in Shewanella loihica PV-4

Name: groES
Annotation: co-chaperonin GroES (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 PF00166: Cpn10" amino acids 2 to 95 (94 residues), 101.1 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 100% identical to CH10_SHELP: 10 kDa chaperonin (groS) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K04078, chaperonin GroES (inferred from 100% identity to slo:Shew_0471)

MetaCyc: 85% identical to cochaperonin GroES (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family co-chaperone GroES" in subsystem GroEL GroES

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA45 at UniProt or InterPro

Protein Sequence (96 amino acids)

>Shew_0471 co-chaperonin GroES (RefSeq) (Shewanella loihica PV-4)
MNIRPLHDRVIVKRSEVESKSAGGIVLTGSAAEQSTRGEVLAVGNGRILENGTVQPLDVK
VGDIVIFNEGYGVKKEKIDGQEVLILSESDLMAVVE