Protein Info for Shew_0469 in Shewanella loihica PV-4

Annotation: pentapeptide repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00805: Pentapeptide" amino acids 18 to 50 (33 residues), 21 bits, see alignment 2.9e-08 amino acids 62 to 101 (40 residues), 29 bits, see alignment 9.6e-11 amino acids 87 to 111 (25 residues), 16.9 bits, see alignment (E = 5.7e-07) amino acids 102 to 139 (38 residues), 19.1 bits, see alignment 1.2e-07 amino acids 139 to 169 (31 residues), 21.8 bits, see alignment 1.7e-08 PF13599: Pentapeptide_4" amino acids 59 to 107 (49 residues), 30.4 bits, see alignment 5.9e-11 amino acids 103 to 170 (68 residues), 28.7 bits, see alignment E=2.1e-10 amino acids 122 to 190 (69 residues), 27.4 bits, see alignment E=5.3e-10

Best Hits

Swiss-Prot: 52% identical to QNR_VIBPA: Pentapeptide repeat protein VPA0095 (VPA0095) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0469)

Predicted SEED Role

"Qnr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA43 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Shew_0469 pentapeptide repeat-containing protein (RefSeq) (Shewanella loihica PV-4)
MDDLQHETLERDYFEHDFSGKDLQGLLFRRCRFVRCSFNRADLTDCHFKQCQFVEPGDLL
GCDFSYATLINAKFSDCRLNLARFTGARCFGAEFRASNLQGADFYRASFANQIGINHYFC
SAVFSGCNLAYGNLSQVILEECELTDNRWRGANLTGASLKGSDLSGGEFSPELWGEFDLR
GANLTRVDLEGLDPREVALEGVMIDAWQQSQLLAPFGLIVCGE