Protein Info for Shew_0412 in Shewanella loihica PV-4

Annotation: secretion protein HlyD family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF16576: HlyD_D23" amino acids 39 to 269 (231 residues), 48 bits, see alignment E=2e-16 PF13533: Biotin_lipoyl_2" amino acids 44 to 87 (44 residues), 52.9 bits, see alignment 5.1e-18 PF13437: HlyD_3" amino acids 205 to 279 (75 residues), 27.4 bits, see alignment E=9.8e-10

Best Hits

Swiss-Prot: 48% identical to AN36_HELPY: 36 kDa antigen (HP_1488) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to slo:Shew_0412)

Predicted SEED Role

"Membrane-fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Y6 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Shew_0412 secretion protein HlyD family protein (RefSeq) (Shewanella loihica PV-4)
MRTNRILAIVALIALVAILAYGLMLAHTPKAERLQGQIEAREYNISSKVPGRVAQVMVRR
GDQVAEGDLLFAIDSPELNAKLMQAQGGRDAAKALQQEADNGARKQQVAASKEQWLKAKA
AATLAETTYKRVEALFSEGVLARQKRDEAFTQWQAAKYTQQAAYAMYQMAEEGAREETKA
AAEGNARMAEGAVKEVSAILADSQMRSPKSGEVSEVLLHPGELAPSGFPVVSVIDMQDAW
AVFQVREDQLKGFKVGDTLEVEIPALGERYPFKVAHISVMGHFATWRSTESGHDFDMRTF
EMELRPVTPIADLRVGMTSLLVQ