Protein Info for Shew_0411 in Shewanella loihica PV-4

Annotation: outer membrane efflux protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02321: OEP" amino acids 28 to 244 (217 residues), 71.6 bits, see alignment E=4e-24 amino acids 269 to 448 (180 residues), 96.2 bits, see alignment E=1.1e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0411)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Y5 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Shew_0411 outer membrane efflux protein (RefSeq) (Shewanella loihica PV-4)
MRYSHIVWLSLLALAGNAAQAKELAFGDAWQQLLQVSDKLQASQQEVNRAQAEKAAGEDL
NLPSLSINGSYTRLEKPLELDLRDLNPLASLDPATLPPALGGALGAIPGSLFITPFTEQD
VFRSSLQAMWPIYTGGRISAAQGIHEAQVAEKEQQHQLSTRDLFVQLVDRYYGVAVSHAL
MATRGQLVDALTEHAEHAVKLEQQGQIAKVERLNAQVALENARVDYASAKRQLEMSQIAL
SRMLHQSDVDTASKLFLLDNPPSLGLLSQLTLTSHPALKLLEAKETQANGLIDVEKGSYY
PSVFLYGNYTLYEDDSLLAKMEPDWMVGVGVKIPLISRDGRSGKVEAARSALLQARYTKA
QTQQDLSLLLDQSYRQLQQAREETESLDLSLSLAKENKRLRDLAFSQGLSTSIEKVDAEL
KLSGVQTQQLAAQYRYVQAYARLMAISGQLDEFIGRSRTAQERADAH