Protein Info for Shew_0397 in Shewanella loihica PV-4
Annotation: methylation site containing protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K10924, MSHA pilin protein MshA (inferred from 100% identity to slo:Shew_0397)Predicted SEED Role
"MSHA pilin protein MshA" in subsystem Mannose-sensitive hemagglutinin type 4 pilus
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3Q9X1 at UniProt or InterPro
Protein Sequence (163 amino acids)
>Shew_0397 methylation site containing protein (RefSeq) (Shewanella loihica PV-4) MNKQKGFTLIELVVVIIILGILAVTAAPKFINLQSDARKSTVEGMKGALQGANTLLYSKA AIQGKEKDANSNDANNVDTTGDGTADTKAVYGYVKADATELAKVLEVDSADWTIAAPAAG VSTADIIIHPADFTPAADKKCFLEYTDATSSSLPVYKTVLDNC