Protein Info for Shew_0391 in Shewanella loihica PV-4

Annotation: TPR repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details PF14559: TPR_19" amino acids 213 to 275 (63 residues), 34 bits, see alignment E=1.1e-11 PF13428: TPR_14" amino acids 235 to 275 (41 residues), 24.1 bits, see alignment 1.4e-08 PF13432: TPR_16" amino acids 240 to 289 (50 residues), 23.5 bits, see alignment 2.1e-08 amino acids 307 to 361 (55 residues), 26.1 bits, see alignment 3.3e-09 PF13181: TPR_8" amino acids 338 to 365 (28 residues), 12.8 bits, see alignment (E = 4.2e-05)

Best Hits

KEGG orthology group: K12284, MSHA biogenesis protein MshN (inferred from 100% identity to slo:Shew_0391)

Predicted SEED Role

"MSHA biogenesis protein MshN" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9W5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Shew_0391 TPR repeat-containing protein (RefSeq) (Shewanella loihica PV-4)
MSVINTMLKDLDKRQQSHGLDELPVPPLQYRQAPQSRLPWLLLALLALLLLAMGYLAWDR
YAALERTNLALQQDNQILAQEIASGDLKQPSVEKVASNETALAADEAPAEESKTEASLAA
DAQVTAKIESSAEASAELMTTSNTDPVAEPKVESKPAVESKPSAKSQRVRVEQTADANTA
KTTGSMAVTEVKLSPEALAEKRFSQGKSAQEGGQLSQAVDDFSEAIRLDPTLHGARQHLA
ALYYGQGQLGEAKTVLQQGLARYPQELDYALMLAKVLEAQGDSQGALAALGTIPDDHLLA
KQKWVQQSHLAQQASQFALAEESYRRLARVEPTQAKWWMGLAYALDSQQKYTSAKQAYGQ
ALGLSGLSQQASDFIQQRLAQLGDIE