Protein Info for Shew_0383 in Shewanella loihica PV-4

Annotation: malate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 187 to 206 (20 residues), see Phobius details PF00390: malic" amino acids 19 to 115 (97 residues), 72.2 bits, see alignment E=5.1e-24 amino acids 113 to 148 (36 residues), 26.1 bits, see alignment 7.2e-10 PF03949: Malic_M" amino acids 164 to 370 (207 residues), 94.2 bits, see alignment E=8.5e-31

Best Hits

Swiss-Prot: 69% identical to MAEB_HALED: NADP-dependent malic enzyme (maeB) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K00029, malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC: 1.1.1.40] (inferred from 100% identity to slo:Shew_0383)

Predicted SEED Role

"NADP-dependent malic enzyme (EC 1.1.1.40)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 1.1.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9V7 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shew_0383 malate dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MADFRQQALDYHEFPVPGKTAVSLTKPAETSMDLALAYSPGVAEPVREIAANPDDAYRYT
AKGNTVAVISNGTAILGLGNLGPLASKPVMEGKALLFKHFANIDATDIEVKHRTAEEFIN
TVEAIADTFGGINLEDIKAPECFEIEKALIERCNVPVFHDDQHGTAIVTAAGMINALEIQ
GKKLEEAVFVCMGAGAAAIACMTMLVKCGVQRENVYMLDRKGVIHTRREDINEYKALFAN
NTDKRTLQDVIKGADAFLGLSGPDVLSAEDVALMADKPVIFACSNPDPEIKPELAHDVRK
DLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRAAKINDEMKIAAVHAIAALAKEPVPAEV
LAAYPDVTELKFGPDYVIPKPMDPRLLSNVAKAVAQAAIDSGVAALPTLPEHYMA