Protein Info for Shew_0381 in Shewanella loihica PV-4

Name: rpmE
Annotation: 50S ribosomal protein L31 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 70 PF01197: Ribosomal_L31" amino acids 1 to 65 (65 residues), 108 bits, see alignment E=1.1e-35 TIGR00105: ribosomal protein bL31" amino acids 1 to 66 (66 residues), 116.7 bits, see alignment E=1.9e-38

Best Hits

Swiss-Prot: 100% identical to RL31_SHELP: 50S ribosomal protein L31 (rpmE) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02909, large subunit ribosomal protein L31 (inferred from 100% identity to slo:Shew_0381)

MetaCyc: 61% identical to 50S ribosomal subunit protein L31 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-dependent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9V5 at UniProt or InterPro

Protein Sequence (70 amino acids)

>Shew_0381 50S ribosomal protein L31 (RefSeq) (Shewanella loihica PV-4)
MKPGIHPEYAEITATCTCGNVIKVNSTAGKPLHLDVCGACHPFYTGTQKVMDTGGRIDKF
NKRFGMLGKK