Protein Info for Shew_0374 in Shewanella loihica PV-4

Name: hslU
Annotation: ATP-dependent protease ATP-binding subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 441 (438 residues), 727.7 bits, see alignment E=2.7e-223 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 23.6 bits, see alignment 9.1e-09 PF00004: AAA" amino acids 53 to 106 (54 residues), 32 bits, see alignment 3.2e-11 amino acids 240 to 330 (91 residues), 27.8 bits, see alignment E=6.3e-10 PF07724: AAA_2" amino acids 179 to 327 (149 residues), 101.9 bits, see alignment E=8.3e-33

Best Hits

Swiss-Prot: 100% identical to HSLU_SHELP: ATP-dependent protease ATPase subunit HslU (hslU) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to slo:Shew_0374)

MetaCyc: 78% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9U8 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Shew_0374 ATP-dependent protease ATP-binding subunit (RefSeq) (Shewanella loihica PV-4)
MSEMTPREIVHELDSHIIGQQNAKRSVAIALRNRWRRMQLDAALRQEVTPKNILMIGPTG
VGKTEIARRLAKLAKAPFIKVEATKFTEVGYVGKEVEQIIRDLTDAAVKLTREEQMAKCK
FRAEEAAEERILDALLPKPKEDWDTEKKDDTGTRQVFRKKLREGQLDDKEIEIDIAAPQV
GIEIMSPPGMEEMTSQLQSMFQNMGPGASKRRKMTIKEAYKLLIEEEAAKLVNPDDLKEQ
AIELVEQHGIVFLDEIDKICKRGDTSGPDVSREGVQRDLLPLVEGCTVNTKHGMVKTDHI
LFIASGAFQMSKPSDLIPELQGRLPIRVELEALSANDFKRILTEPHASLTEQYVALMATE
GVKVEFSESGIERIAQAAWQVNERTENIGARRLHTVMERLMEDLSFEASDKSGSTTVIDA
DYVNAHLENLVQDEDLSRFIL