Protein Info for Shew_0370 in Shewanella loihica PV-4

Annotation: protoheme IX farnesyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 16 to 294 (279 residues), 283.1 bits, see alignment E=1.6e-88 PF01040: UbiA" amino acids 30 to 273 (244 residues), 189.3 bits, see alignment E=3.7e-60

Best Hits

Swiss-Prot: 100% identical to CYOE2_SHELP: Protoheme IX farnesyltransferase 2 (cyoE2) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to slo:Shew_0370)

MetaCyc: 60% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9U4 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Shew_0370 protoheme IX farnesyltransferase (RefSeq) (Shewanella loihica PV-4)
MIRHSTSTQVAAPLGAYLQVTKPGIIMGNLIAVVGGFLLAARGEVDAVLMLATLVGLSLV
VASGCAINNYIDRDIDAKMQRTCRRATVTGAIPLKQVLGLGIALGVLGFGLLAWFTNLAA
LLFAAFGYLVYVGLYSLYMKRNSVYGTLVGSLSGAVPPVVGYCAVTGRMDGAALILLAMF
SLWQMPHSYAIAIFRFKDYEAANIPVLPVAQGVEKAKLHIVFYIALFALVSTLLPLAGYT
GVGFMAVSCVTSFWWLLMALKGYRSDVNLLRWSRQVFGFSILTIAILSLTMALDFQVAGQ
APLLAMLG