Protein Info for Shew_0368 in Shewanella loihica PV-4

Annotation: cytochrome c oxidase, subunit III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 16 to 205 (190 residues), 45.2 bits, E=5.8e-16
• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 28 to 207 (180 residues), 267.6 bits, E=3.5e-84

Best Hits

Swiss-Prot: 68% identical to CYOC_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 100% identity to slo:Shew_0368)

MetaCyc: 66% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A3Q9U2 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Shew_0368 cytochrome c oxidase, subunit III (RefSeq) (Shewanella loihica PV-4)
MSIAIPADLSVTQVETLHEEHHDTGENTLLGFWIYLMTDCILFASAFATYAVLYMNTDGG
VSGKDVFELDFVLIETAALLLSSITYGLALIFAKRHHKGATLAWLAVTFALGCVFIGMEV
NEFHHLILEGNGPQRSAFLSAFFALVGMHGLHVSAGLVWMAIMMLEVVKRGTGGRTLTRL
NCLSLFWHFLDIVWICVFTVVYLMGVLL