Protein Info for Shew_0357 in Shewanella loihica PV-4

Annotation: copper ABC transporter, permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 16 to 246 (231 residues), 102.4 bits, see alignment E=2.8e-33 PF12730: ABC2_membrane_4" amino acids 30 to 177 (148 residues), 28.3 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 41% identical to NOSY_PSEST: Probable ABC transporter permease protein NosY (nosY) from Pseudomonas stutzeri

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to slo:Shew_0357)

Predicted SEED Role

"Nitrous oxide reductase maturation transmembrane protein NosY" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9T1 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Shew_0357 copper ABC transporter, permease protein (RefSeq) (Shewanella loihica PV-4)
MMSTSVKRPSLQLIRVIATKEMKDSVRNRWVMVVFAIFWLLALCMTFAGSAVSGTLSLPS
LSSVVASLTTISVFIIPLAAILLSYDAFVGEEEAGTLQLLLTYPVSKSQILVGKLLAHGG
VIFTAIASSYASSAAMLILFGRGEPWGEILSSFALLIASSCLLAVIFILISYLVSLKSAE
KARAVGSLLALWFALVLIYDLLLLLLLVADLGYASQWLVNLLILLNPTDLYRATNMLGAS
APLGSLGLLAQYEWSLPLLLSAGVAWLLSLLYWTRRVFIHKLV