Protein Info for Shew_0350 in Shewanella loihica PV-4

Annotation: peptidylprolyl isomerase, FKBP-type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01346: FKBP_N" amino acids 40 to 146 (107 residues), 78.4 bits, see alignment E=6.3e-26 PF00254: FKBP_C" amino acids 154 to 240 (87 residues), 96 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 45% identical to FKBA_AERHY: FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA) from Aeromonas hydrophila

KEGG orthology group: K03772, FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC: 5.2.1.8] (inferred from 100% identity to slo:Shew_0350)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9S4 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Shew_0350 peptidylprolyl isomerase, FKBP-type (RefSeq) (Shewanella loihica PV-4)
MIESVNMKANLLKSCRVTTLALACTWSFFAAASESPQEVEDASYALGASVGHYISGKIYN
QVDLGAQIKVDTVIQGVIDALKGEGKMSNEEILTHLNARAEWLNNAKAAKLEALASKHQA
EGQAYLAANQAKPGVKVTESGLQYEVIKQGDGPKPVESDVVTVHYVGKLLDGTEFDNSYE
RDEPNRFALLSVIDGWKEGIALMNVGSTYRLTIPAELAYGKEVVGVIPPGSTLIFDVELL
KMEAPGENAHGMGLSGMGMGGMMGMGH