Protein Info for Shew_0347 in Shewanella loihica PV-4

Annotation: cytochrome c assembly protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 262 to 278 (17 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details amino acids 436 to 455 (20 residues), see Phobius details amino acids 461 to 481 (21 residues), see Phobius details amino acids 502 to 520 (19 residues), see Phobius details amino acids 623 to 643 (21 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 66 to 643 (578 residues), 590.4 bits, see alignment E=2.5e-181 PF01578: Cytochrom_C_asm" amino acids 101 to 308 (208 residues), 163.6 bits, see alignment E=5.4e-52 PF16327: CcmF_C" amino acids 330 to 642 (313 residues), 250.4 bits, see alignment E=2.8e-78

Best Hits

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 100% identity to slo:Shew_0347)

Predicted SEED Role

"Cytochrome c-type heme lyase subunit nrfE, nitrite reductase complex assembly" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9S1 at UniProt or InterPro

Protein Sequence (663 amino acids)

>Shew_0347 cytochrome c assembly protein (RefSeq) (Shewanella loihica PV-4)
MSSLVPLAEGETMTAEIGLLLLIISLTLCLLTAMSPVMPACGVKLRLKPYQPLFIRLNSL
AQVASLFILAYLFLSNDFSVAYVANNSNTQLASLYKLAAVWGGHEGSMLFWIGAMGIWSC
VLSLQPNHKDRFFHYLHAVLGAIQAGLIAFLLIGSNPFARLLPGIPVEGRDLNPILQDIG
LILHPPLLFIGYVGLAVCFAAAIAALLDNSQPLKQHCRLMRPWAILAWAMLTGGNAFGSW
WAYNELGWGGWWFWDPVENASFIPWLVATALMHSLILGERRDRFHGTSLFLAILGFSLCL
LGTFLVRSGVVQSVHAFAADPLRGGAMLTLFALVSICGFTLLLQRLPSLYRPVNSNMLSR
ESLMQLGNLLLLVAAISILLGSCYPLLYEVASGQSISVGAPYFNSLFIPLTWLICLVMGA
APLMRWQVSNPGMLRQLTALAAICLFIGLTLNTLLLKEFAAHFLLGSFACLWLLGCTGLY
LHKRLAAYTGAGDNRRCYAMSFAHLGVALSILGATCSSYFQQEELLRMGPGQGKEVAGYT
FIYRATETVSHTSYSALQAKIEVRDRREQHLAYLYPQRQTFNSNAMQISAAGIHRSLFAD
LYISMGNRLSEEEFLIRISYKPLIGWIWIGGLIMMFAGLSLLLPRKVRRLSRAPSPQLAV
KGA