Protein Info for Shew_0329 in Shewanella loihica PV-4

Annotation: Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF27465: Fis_N" amino acids 1 to 49 (49 residues), 40.8 bits, see alignment E=2.3e-14 PF02954: HTH_8" amino acids 60 to 98 (39 residues), 57.2 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 100% identical to FIS_SHELP: DNA-binding protein Fis (fis) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 100% identity to slo:Shew_0329)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Q3 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Shew_0329 Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MFDQTTQPEAHQLTVGKIETANGTIKPQLLRDAVKRAVTNFFAQMDGQEAEEVYEMVLCE
VEAPLLDIIMQHTRGNQTRAANMLGINRGTLRKKLKKYGMN