Protein Info for Shew_0328 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF04405: ScdA_N" amino acids 15 to 68 (54 residues), 71.3 bits, see alignment E=4e-24 TIGR03652: iron-sulfur cluster repair di-iron protein" amino acids 18 to 234 (217 residues), 244.9 bits, see alignment E=4e-77 PF01814: Hemerythrin" amino acids 92 to 234 (143 residues), 83.8 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 40% identical to YTFE_DICP7: Iron-sulfur cluster repair protein YtfE (ytfE) from Dickeya paradisiaca (strain Ech703)

KEGG orthology group: K07322, regulator of cell morphogenesis and NO signaling (inferred from 100% identity to slo:Shew_0328)

MetaCyc: 39% identical to iron-sulfur cluster repair protein YtfE (Escherichia coli K-12 substr. MG1655)
1.7.99.-

Predicted SEED Role

"Nitric oxide-dependent regulator DnrN or NorA" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Q2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Shew_0328 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSLSTHSPLASEFAEETVGSLVAGDFRRAHVFSQFGIDFCCGGKRTLVKACDRAGIALVE
VEAALQAVKAEGMQEDSLNQLPLSELIDYIEATHHDYVREKAPLLIEYSQKMVRAHGEHY
DEIKPFAGWVRALIEDLMPHLMKEEQILFPAIRAMAAGEQVSGCFGHIGNPINAMEHEHD
EASEIVERLRALTNDFTPPPHACTTWRICYATLKEFVADLQQHIHIENNILFPKTLAI