Protein Info for Shew_0323 in Shewanella loihica PV-4

Name: dapF
Annotation: diaminopimelate epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 2 to 278 (277 residues), 325.2 bits, E=1.7e-101
• PF02567: PhzC-PhzF
  • amino acids 4 to 232 (229 residues), 27.7 bits, E=1.9e-10
• PF01678: DAP_epimerase
  • amino acids 4 to 123 (120 residues), 112.7 bits, E=1.1e-36
  • amino acids 157 to 272 (116 residues), 116.7 bits, E=6.7e-38

Best Hits

Swiss-Prot: 100% identical to DAPF_SHELP: Diaminopimelate epimerase (dapF) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to slo:Shew_0323)

MetaCyc: 70% identical to diaminopimelate epimerase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

See A3Q9P7 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Shew_0323 diaminopimelate epimerase (RefSeq) (Shewanella loihica PV-4)
MIHFTKMHGLGNDFMVVDGVTQNVYFSPEQIKRLADRNFGIGFDQLLLVEPPYDPDLDFH
YRIFNADGSEVEQCGNGARCFARFVKSKGLINKQKIKVSTSSGKMTLRLERDGSVTVNMG
IPVLEPSRIPFNAKKAEKTYLLQADMPEGMQTFLCGAVSMGNPHCVLEVDDVANADVERI
GSLLTKHERFPKGVNVGFMQVVDANHIKLRVYERGAAETLACGSGACAAVAVGQLQGKLA
RRVRVDLPGGSLTINWEGEGKPLWMTGPAEHVYDGQIQQ