Protein Info for Shew_0312 in Shewanella loihica PV-4

Annotation: ABC transporter-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 transmembrane" amino acids 176 to 197 (22 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 23 to 716 (694 residues), 932.3 bits, see alignment E=8.9e-285 PF00664: ABC_membrane" amino acids 177 to 436 (260 residues), 59.5 bits, see alignment E=9.1e-20 PF00005: ABC_tran" amino acids 505 to 654 (150 residues), 115.5 bits, see alignment E=6e-37 PF13304: AAA_21" amino acids 625 to 688 (64 residues), 27 bits, see alignment E=9.4e-10

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to slo:Shew_0312)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9N6 at UniProt or InterPro

Protein Sequence (726 amino acids)

>Shew_0312 ABC transporter-related protein (RefSeq) (Shewanella loihica PV-4)
MQASASPKTEQWTVSASQRVTVDPLLDSLVLLTEYFGSPCSSESLAAGLPLSGSILTPEL
VPQAAGRAGLAAKLTRKGLDQISPILLPCILLLKDKNACLLREIDIDKDRAVIQLPETGG
EEELSIEALEAMYVGYLFLVKQQYRGDMGLDLHLHDSRTHWLIQTLKDSAPIYRDALIAS
VLVNLFALVSPLFIMNVYDKVVPNLAFESLWVLAIGAGIAYIFDLIMRQLRAYLIDVAGK
KVDIIVSSRLFAKAIGIPLEKRSPSIGGMARQLGEFDSIREILTSATITTLVDLPFALFF
MLIIYIVAGDLAIIPVIGGCIIIGYTLLMQPRLKAAIEESNKFSSLKHGHLIESLASIES
IKSSGAEGLVQKSWQQMIGHTANWQLKVKKISTSVTNVANFTVQLSVVCVVILGVYRVAD
NDISMGGIIAAVILSSRAISPMAQLAGLMTRGNHTASALRQLDQIMTQEDEFENKGHLVS
KHRLKGQINADHVSFNYPGSERPVLHPMSLSIAPGERIAIIGRNGSGKSTLAKLLVGLYQ
PTKGSLRYDGLDSAQIHPTDLRRNFGYLPQDITLFHGTIRDNILFGTRQVTEHQLIRAVQ
LSGVNQFTDIETEGLDQQVGEGGQSLSRGQRQTIALARATLNDPPVLLMDEPTASLDARA
EKQFIRAMRNVSKERTLLLITHKMHLLNLVDRILVLDRGHLVADGPKEQVLNQLAKGLLS
GGPKSE