Protein Info for Shew_0311 in Shewanella loihica PV-4

Annotation: HlyD family type I secretion membrane fusion protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 27 to 460 (434 residues), 492 bits, see alignment E=7.9e-152 PF25994: HH_AprE" amino acids 104 to 305 (202 residues), 84.6 bits, see alignment E=1.5e-27 PF26002: Beta-barrel_AprE" amino acids 347 to 437 (91 residues), 74.3 bits, see alignment E=1e-24

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to slo:Shew_0311)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9N5 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Shew_0311 HlyD family type I secretion membrane fusion protein (RefSeq) (Shewanella loihica PV-4)
MSKHLTTQDLEMVDDVYGAMMTDAPTSHRLIIWALAALAFSFLVWAYFAELDRVTTGTGK
VIPSSQVQVIQSLDGGIMKELYVREGMTVTKGQPLVRIDDTRFRSDFAQQEQEVYSLQAN
VIRLRAELNSITISDVAADWREQVKIAKQPLQFPPELTESEHDLIERQRDEYSGRLDNLS
NQLEILARQIQQKQQETEELASKINTLTTSFQLVTRELELTRPLADKGIVPEVELLKLER
NVNDIRGELSSLRLLRPKLKASQDEAILKRREAVFVYAAEARTQLNEMQTRLSRINEAQV
GARDKVSKAEIVSPVNGTIKTVHINTLGGVVQPGIDIIEIVPSEDQLLIETKIIPKDIAF
LHPGLPAVVKVTAYDFTRYGGLNGVVEHISADTTQDEEGNSFYLVRVRTELSSLTKDDGT
LMPIIPGMLTTVDVITGQRSVLEYILNPILRARDTALRER