Protein Info for Shew_0306 in Shewanella loihica PV-4

Annotation: diguanylate cyclase/phosphodiesterase with GAF sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 882 PF01590: GAF" amino acids 60 to 196 (137 residues), 35.3 bits, see alignment E=3.9e-12 amino acids 256 to 398 (143 residues), 39.6 bits, see alignment E=1.9e-13 PF13185: GAF_2" amino acids 92 to 199 (108 residues), 39.1 bits, see alignment E=2.2e-13 amino acids 256 to 399 (144 residues), 41.8 bits, see alignment E=3.2e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 448 to 611 (164 residues), 140.4 bits, see alignment E=2.2e-45 PF00990: GGDEF" amino acids 450 to 607 (158 residues), 169.8 bits, see alignment E=1e-53 PF00563: EAL" amino acids 630 to 861 (232 residues), 119.4 bits, see alignment E=4.1e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0306)

Predicted SEED Role

"GAF domain/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9N0 at UniProt or InterPro

Protein Sequence (882 amino acids)

>Shew_0306 diguanylate cyclase/phosphodiesterase with GAF sensor (RefSeq) (Shewanella loihica PV-4)
MFRDKTDQHSPREVGRLYKRISRLKSLARKYKRSEIVQNTLLDISNLAARVERAEDFYAG
IQTNLNRLLPADNFFIAILNRETNKLGVPFFVDEKDQHPSQLYPSEELSTTLNSGLTGYV
LRSQQPLLCDDDKFEQLLASGEIVSRGSSCHQWLGLPIFSSDQTIGVIAVQSYDANITYG
EIEVELMTFISQHISGVIERVQYQHNLEAAIEHRTKELSVAYDKLKQEVTERRRAENLQK
SLFEIAELSNATIDHQSFYRELHRVISHLLPANNCYIALLEDNGRELHFPFYVSQLNVGA
PQRRPLADGLTEFILKHKRPLLLDGSDIKALIKAGQLYAKAPQLNYAETIHQWIGVPLFI
QGIVKGALTIYSFTPSQTYQEKDLDLLTFVSQHIAAAIERKLSAESLKQSYEQLEEKVAQ
RTRALAMLNQDLEKEIAQRRKVEQQLVHDASHDTLTGLPNRAMFMERLAQAVKHVRRHAR
DRFALLFIDLDRFKLINDTLGHLQGDRFLIETARRLNLCIRSNDTLGRIGGDEFVILLDS
INTNSDAIEVAERILGELSEPYQLSNQSFTSGASIGIAFSGHSSGDTSESLLKDADAAMY
QAKSNGKGCFVIFDHNTSHQQSHDITLEIELREAIAKQELALQYFPVLALATQEVLALEP
RLYWQHEQLGKIKQDQLSNIAEHCNLTKELDLYLFDQLNSDYDKVMQQVDGQVQLHIKLA
SQHLKHKHAVRKLKNRIKQSYYKADDIWVFFNEKAFVADSDSHIQAFDLLAKQAINLGLC
AYGSAHTALSSLSFLPLSGLKLDPSYISHLNNPQQKRLLKAHQLTASALELTLFVEGVKT
DLHRQQLVSLGFDQGQGQALGESIDPSKLPEPRKRPSGCISA