Protein Info for Shew_0303 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 12 to 14 (3 residues), see Phobius details transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details PF06123: CreD" amino acids 13 to 439 (427 residues), 430.8 bits, see alignment E=2.9e-133

Best Hits

KEGG orthology group: K06143, inner membrane protein (inferred from 100% identity to slo:Shew_0303)

Predicted SEED Role

"Inner membrane protein CreD-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9M7 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Shew_0303 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MLSRLPLANSPLSKKLIFIAILTLVAMIPLGLIESLTSDRQHLYHGMVNEIGRSWGEQQT
IAGPALVIPYTYEVVQESISDTGKMTKARHTYDSELVVLPEQLNLAVSLKHSFLSRGIFR
SLVYQSQVTGSAQFRLEAYSLPNLVNLHPDQARLVFGISANQAIDKLNRFAAKADQQAAA
PQRLMPGTGLEQLRGLDRGFHQPIALSPDSEQLTVNFDISLRGSQGISVLPIGQQTEVTL
SADWPHPSFHGLLPTERQITAQGFSAQWDVSHLTRNYPQVFTKTQEVNLQEIAAQATLFE
PVTHYGKIERAVKYGLLFIMLTSTMLLIFELGQQQVLSSIQYLLVASAMALFYLLLLSLS
EHISFGYAYLLAASVPLLSVSAYIASVTASNRRGAFMAIMLLALYSVLYSILKLEDYALL
MGSGLLMMVLLLLMYLTRHQIEAPSTPSQE