Protein Info for Shew_0300 in Shewanella loihica PV-4

Annotation: sodium:neurotransmitter symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 216 to 241 (26 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 357 to 382 (26 residues), see Phobius details amino acids 389 to 406 (18 residues), see Phobius details amino acids 426 to 450 (25 residues), see Phobius details PF00209: SNF" amino acids 8 to 122 (115 residues), 71.9 bits, see alignment E=2.4e-24 amino acids 147 to 448 (302 residues), 90.1 bits, see alignment E=7.4e-30

Best Hits

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 100% identity to slo:Shew_0300)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9M4 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Shew_0300 sodium:neurotransmitter symporter (RefSeq) (Shewanella loihica PV-4)
MSAKDLGHFSSRIGFIMAAAGSAVGVGNIWGFPTQAATHGGGAFLLVYLVLIFLLGYPML
VAELMIGRHGQTNPADAMAKLGSSKLSRNLGKTIGFASIITATLICTFYSILSGWFVSFT
LAPIARLVGMQDIALWLTSFSLERNLLFTLIFILMVVLVIRQGVQQGIEAWSKRLMPLLL
AILILGVAYILTQPGASQGLNALLVPDFGRIWEPQVLIGALGQTFFSLTVGTGAMMVYGA
YLNRQENLAKLTAYVTLTDTSVAFLAALMIIPAMYVAQHNGVQIFAADGSLLNADTLVFT
VLPALFDSLGGLAGQLIAIVFFILMTIAGLTSAISIVEVPTSYMVEKTEIQRHSATYLVG
GGIALLATIMVFNFDALFALVITLTTERAQPFIALGIALYTGWVWHRNSLLKAIAAQEGA
KLDGLFWRIWPVYVKYVCPVLILAIILQLLTA