Protein Info for Shew_0298 in Shewanella loihica PV-4

Annotation: Zn-dependent hydrolase of the beta-lactamase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF13483: Lactamase_B_3" amino acids 94 to 301 (208 residues), 54.7 bits, see alignment E=1.3e-18 PF12706: Lactamase_B_2" amino acids 109 to 301 (193 residues), 178.2 bits, see alignment E=1.6e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0298)

Predicted SEED Role

"Outer membrane protein RomA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9M2 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Shew_0298 Zn-dependent hydrolase of the beta-lactamase fold (RefSeq) (Shewanella loihica PV-4)
MLTSNLINSSSAPQALASGDQLASREPAAHHRSDGGFQNTATNLTENSGMGAILMRYLTE
TRIDASPSKAIPLMPLTRDGIAALPDSQDSVIRLGHSSILLKIAGQTWLIDPVFSDRASP
FSFIGPKRFHQPPIALEQLPEIDGVLISHDHYDHLDEESIKQLHHKVKRFIVPLGVEQHL
LRWGVANDKVQPLDWWQSVTLGKLSITATPTQHFSGRGLWDKNQTLWASYVIQSDRSKLY
FSGDSGYFDGFKAIGERFGPFDLTMIETGAYDKDWPSIHMTPEQSLQAHLDLGGRQMMPI
HNGTFDLAFHSWYEPLERIAALAADANTQLITPIVGQVLDIHNTPESVAWWREEQLNLAL
NE