Protein Info for Shew_0286 in Shewanella loihica PV-4

Annotation: extracellular solute-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00497: SBP_bac_3" amino acids 31 to 261 (231 residues), 48.5 bits, see alignment E=3.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0286)

Predicted SEED Role

"FIG01057876: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9L0 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Shew_0286 extracellular solute-binding protein (RefSeq) (Shewanella loihica PV-4)
MVSWGRLVTGLCCGFALLFSALPALATASVTICVENTEFPPFNYFDRNQSVEPRSIGYDI
DILNLAFGQSVLSHKVIALPWNRCLKEVKQGTVDAAMSASLNSERRRDYLISTPYYYLTP
SYYYLKSDFPKGVEVQRLEELNHYGSVCGIKNFNYENFGLKPDFHLFQIRSLAHLPEMLT
KKRCQFFLARKETLSGTLAINKMEDFYTRLAGITAPNAKPEPFYMLISKNSPHKETIKQL
FDAKVDSLNKQGKLRPLLEHHLQLLSQTY