Protein Info for Shew_0285 in Shewanella loihica PV-4

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 121 to 273 (153 residues), 127.3 bits, see alignment E=2.3e-41 PF00990: GGDEF" amino acids 122 to 272 (151 residues), 145.7 bits, see alignment E=5.5e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0285)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9K9 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Shew_0285 diguanylate cyclase (RefSeq) (Shewanella loihica PV-4)
MPRNDTLNANAPKGGDMTAFAIFIVLIGLMGLLASLIPTYQICQLKPPQTQGWHLLLFMI
GMFIFGYLGFLWMLLNRETGPLETVVSLVFSAGGAFVWLVVKMSMKTIVKLQDTLEDKHY
QAYHDSLTDLPNRHMLYETMERLIKENGSPFGFIMMDLNDFKMINDNLGHDAGDKVLEII
AYRIERIMPPQALPVRLGGDEFAVLLPKSELGQAQRLAKQIQKAVIEDIHCEGHLLAVGI
SIGIALYPQDGDDRKTLMKHADIAMYRSKQNNSDYETFSQVTDMPAPLGQFSP