Protein Info for Shew_0253 in Shewanella loihica PV-4

Annotation: secretion protein HlyD family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details PF25917: BSH_RND" amino acids 58 to 238 (181 residues), 53.1 bits, see alignment E=3.5e-18 PF25954: Beta-barrel_RND_2" amino acids 247 to 286 (40 residues), 26.9 bits, see alignment 6.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0253)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9H7 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Shew_0253 secretion protein HlyD family protein (RefSeq) (Shewanella loihica PV-4)
MSDNNVHTSAEQSDKKISQARSFTYYIFALVAALWLYTLWADRMTPMTDQARVNGQLIRI
SPEVSGPISQVLITNNSIVKAGDELVTIDPRPFELAVKAAKFDLQQAAQSYEADSAAISV
AQANEVAARVKVNNAKKNVERNRVLANKGTISQAVMDNIIAELETAQAGLAQASSALEKA
KQEFGPRGIDNPEIQSVLNRQEQALLNLNHTKLTAPANGVITNMDVAVGDYAAAGQPLLT
FINNNNLWLTAMVRENSLAHLKPGDKVKIVFDATPGEVYEGKISSIGWGSSGNGSLAQDA
SNGLMTSPTSSSKAQRFPVNIEFTSLPADLNLRYGGRAVVGFYPDESYLGERLQDLWIWA
WSYISYVS