Protein Info for Shew_0250 in Shewanella loihica PV-4

Annotation: MerR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF13411: MerR_1" amino acids 2 to 69 (68 residues), 67.4 bits, see alignment E=6e-22 PF00376: MerR" amino acids 4 to 39 (36 residues), 44.7 bits, see alignment 5.5e-15 PF03848: TehB" amino acids 169 to 249 (81 residues), 21.2 bits, see alignment E=1e-07 PF06325: PrmA" amino acids 173 to 288 (116 residues), 22.5 bits, see alignment E=4.6e-08 PF01209: Ubie_methyltran" amino acids 175 to 287 (113 residues), 28.7 bits, see alignment E=4.9e-10 PF05175: MTS" amino acids 180 to 256 (77 residues), 23.7 bits, see alignment E=1.9e-08 PF13489: Methyltransf_23" amino acids 183 to 309 (127 residues), 35.1 bits, see alignment E=6.7e-12 PF13847: Methyltransf_31" amino acids 186 to 296 (111 residues), 55.2 bits, see alignment E=4.4e-18 PF13649: Methyltransf_25" amino acids 188 to 282 (95 residues), 64.5 bits, see alignment E=7.3e-21 PF08241: Methyltransf_11" amino acids 189 to 285 (97 residues), 61.1 bits, see alignment E=8e-20 PF08242: Methyltransf_12" amino acids 189 to 284 (96 residues), 40.1 bits, see alignment E=3e-13 PF13578: Methyltransf_24" amino acids 190 to 288 (99 residues), 28.1 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0250)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9H4 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Shew_0250 MerR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MYLISELAAKAGISRTTLLYYEKLGLINGQRLDNGYRYYSENDLQRLLLIQQLQSAGLSL
KECEQCLDAKLSRSLLENRLTQLNHEIDKKIHARELLLALLGERPQRELHHSLSQSAPNA
YLNWLSTQGYSEKEALRLKWLSKDMNEHESYMKDFMTVFATLERWGPGSHKDSLKAISLM
SPQTMTDILDIGCGTGTSTLLLADNSIAHITAVDNEPIAIEQLNKKIQNAQLHERISPVC
ASMTELPFQAKSFDAIWAEGCVYIMGMENALKQWKPLLKDNGVLMVSDLVWLTDSPDEET
KQFWLADYPDIQSIPKRLTLFKKHGYDVIEHFSLGVDAWQNYWQPLQGRVEELQAVMPAS
QALLDIKKEISVYERSAAKDFTYQYFILKLAN