Protein Info for Shew_0212 in Shewanella loihica PV-4

Annotation: type IV pilus secretin PilQ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF11741: AMIN" amino acids 157 to 243 (87 residues), 34.9 bits, see alignment E=2.7e-12 TIGR02515: type IV pilus secretin PilQ" amino acids 270 to 679 (410 residues), 516.1 bits, see alignment E=4e-159 PF07660: STN" amino acids 298 to 343 (46 residues), 30.7 bits, see alignment 4.6e-11 PF03958: Secretin_N" amino acids 370 to 433 (64 residues), 52.6 bits, see alignment E=8.9e-18 PF00263: Secretin" amino acids 521 to 679 (159 residues), 167.7 bits, see alignment E=3.6e-53

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 100% identity to slo:Shew_0212)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9D6 at UniProt or InterPro

Protein Sequence (683 amino acids)

>Shew_0212 type IV pilus secretin PilQ (RefSeq) (Shewanella loihica PV-4)
MESSAAKSVLLKKSPLFKVAFGLALLLGVAPYSSAANRLIDVKYHSIVDHQLELQLVFEE
AVKEPEINLNASPAQIILGFDDSLSGLEKDVLPINNVGVKSMSTLQDSEQLKVLVDLAKV
KAYQGKVMGNTYRLTINDEVASRSDVAANPFVNGIKNIDFHRTGDGGGELLVKLNNSSVA
ANVEQVGAKLELKLYNTDIASDLLYVMDVQDFATPVKSFETFKDELTARVLVDVSGQYEY
NYKQEGNLFRLNVRKAERAAVVKEEKKYEGRSLSLNFQSISVRTVLQIIADYNNFNLVTS
DTVEGDITLRLDDVPWDQALDLILQTKGLDKRIEGNILMVAPAEEIAIRESQELKNQQEV
KELAPLYSEYLQINYAKATDIAELLKGDDASLLSARGTVAVDDRTNTLLVKDTEESLENI
HRLVEVLDIPIRQVLIESRMVTVKDDVSEDLGIKWGITDQQGSKGTSGSLEGANDIANGV
VPDIGDRLNVNLPAAVANPTSIAFHVAKLADGTLLDLELSALEQESKGEIIASPRITTSN
QKAAYIEQGVEIPYVESASSGAATVQFKKAVLSLRVTPQITPDNRVILDLEITQDSQGKT
VDTPLGQAVSIDTQRIGTQVLVDHGETIVLGGIYQQQLINRVSKVPVLGDIPFLGYLFRN
TTDKNERQELLIFVTPKIISEQL