Protein Info for Shew_0205 in Shewanella loihica PV-4

Annotation: argininosuccinate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00764: Arginosuc_synth
  • amino acids 12 to 174 (163 residues), 216.1 bits, E=2.9e-68
• TIGR00032: argininosuccinate synthase
  • amino acids 12 to 401 (390 residues), 458.7 bits, E=1e-141
• PF20979: Arginosuc_syn_C
  • amino acids 184 to 401 (218 residues), 238 bits, E=9.5e-75

Best Hits

Swiss-Prot: 100% identical to ASSY_SHELP: Argininosuccinate synthase (argG) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 100% identity to slo:Shew_0205)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See A3Q9C9 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Shew_0205 argininosuccinate synthase (RefSeq) (Shewanella loihica PV-4)
MSIENNKASVKKVVLAYSGGLDTSAIIPWLKETYDNCEIVAFCADVGQGEAELEGLHEKA
IASGASECYIVDLKEELVADYIYPTIATGAIYEGTYLLGTSMARPIIAKAQVEVARKVGA
DAVCHGCTGKGNDQVRFEGCFAALAPDLTVIAPWREWSMVSREDLLDYLAERNIKTTASA
TKIYSRDANAWHISHEGGELEDPWNEPSKEVWTMTVAPEDAPDEPEYVSVEMEAGRITKV
NGQSYTPYGALMALNEIAGAHGVGRIDITENRLVGMKSRGCYETPGGTVMFAALRAIEEL
VLDKTSREWREQVGAKMAHLVYDGRWFTPLCESLLGASQPLANLLNGEVVLKLYKGQAQA
VKKRSPNSLYSEEFATFGEDEVYNQKDAEGFIRLYSLASRIRALNVK