Protein Info for Shew_0196 in Shewanella loihica PV-4

Annotation: redoxin domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00578: AhpC-TSA" amino acids 59 to 165 (107 residues), 60.3 bits, see alignment E=2.8e-20 PF08534: Redoxin" amino acids 60 to 167 (108 residues), 53.8 bits, see alignment E=2.9e-18 PF13905: Thioredoxin_8" amino acids 73 to 164 (92 residues), 39.6 bits, see alignment E=8.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0196)

Predicted SEED Role

"Thiol:disulfide oxidoreductase TlpA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9C0 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Shew_0196 redoxin domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MKSKLATALLSAALALGGYAASVQAYPGMQKKQGGEVQSSVDLINVLPKAYPIDPVPFKD
AQGKAIDFSQYRGQVVMVNMWATWCPPCVRELPAIDRFKGKFDPKQFRVLPISIDMNGKE
KVEPFLASLGMDKFETYYDPQQQLGQVFPLDTIPATFILNQQGELIAFVRTFVDWDDEKA
VKLIESFIASETQKQ