Protein Info for Shew_0190 in Shewanella loihica PV-4

Annotation: cytochrome c biogenesis protein CcmA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01189: heme ABC exporter, ATP-binding protein CcmA
  • amino acids 12 to 201 (190 residues), 243.1 bits, E=1e-76
• PF00005: ABC_tran
  • amino acids 27 to 165 (139 residues), 103.8 bits, E=1.2e-33

Best Hits

Swiss-Prot: 84% identical to CCMA_SHESR: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to slo:Shew_0190)

MetaCyc: 50% identical to cytochrome c maturation protein A (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (8/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

See A3Q9B4 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Shew_0190 cytochrome c biogenesis protein CcmA (RefSeq) (Shewanella loihica PV-4)
MVEEKTATTLVSADNLTCIREERILFDELSFDIQAGEIVQIEGPNGAGKTSLLRILAGLS
RPYAGEAKYKGTDITRCRDEYNDDLLYLGHLAGVKSELTAEENLNFNLRISGYDDFETNQ
ILAKVNLSGFEEALAGHLSAGQHRRTALARLWHTNCKVWLLDEPFTAIDKKGVEELEHLF
LQHAQSGGCVIMTTHQDMSIIGDDILRKIRLDYRFI