Protein Info for Shew_0145 in Shewanella loihica PV-4

Name: secE
Annotation: preprotein translocase subunit SecE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details PF00584: SecE" amino acids 68 to 120 (53 residues), 64.6 bits, see alignment E=3.1e-22 TIGR00964: preprotein translocase, SecE subunit" amino acids 68 to 121 (54 residues), 55.5 bits, see alignment E=2e-19

Best Hits

Swiss-Prot: 50% identical to SECE_ECOLI: Protein translocase subunit SecE (secE) from Escherichia coli (strain K12)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 100% identity to slo:Shew_0145)

MetaCyc: 50% identical to Sec translocon subunit SecE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q969 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Shew_0145 preprotein translocase subunit SecE (RefSeq) (Shewanella loihica PV-4)
MTTNTENQGSSLDIVKWGIVVVLLAAAIIANQMYSEASVLVRAIGVVVAFAIAGFIALQT
EKGKQALTFARESHIEVRKVVWPTRQEALNTTFIVLLATGVLALVLWGMDAVLLRIVNFI
TGV