Protein Info for Shew_0138 in Shewanella loihica PV-4

Annotation: tRNA (uracil-5-)-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF05958: tRNA_U5-meth_tr" amino acids 10 to 365 (356 residues), 606.4 bits, see alignment E=3.3e-186 TIGR02143: tRNA (uracil(54)-C(5))-methyltransferase" amino acids 10 to 365 (356 residues), 603.1 bits, see alignment E=7.7e-186 PF02390: Methyltransf_4" amino acids 213 to 279 (67 residues), 25.2 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 100% identical to TRMA_SHELP: tRNA/tmRNA (uracil-C(5))-methyltransferase (trmA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00557, tRNA (uracil-5-)-methyltransferase [EC: 2.1.1.35] (inferred from 100% identity to slo:Shew_0138)

MetaCyc: 63% identical to tRNA m5U54 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (uracil-5-)-methyltransferase. [EC: 2.1.1.35]

Predicted SEED Role

"tRNA (uracil(54)-C5)-methyltransferase (EC 2.1.1.35)" (EC 2.1.1.35)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q962 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Shew_0138 tRNA (uracil-5-)-methyltransferase (RefSeq) (Shewanella loihica PV-4)
MNVDAMDPQQYDAQLDVKRQKLAQLFVDFETPELEVFASQKAHYRMRAEFRVWHEGEDLY
YYMFDKAQNQKIRCEQFLPASQLINDMMPELMAALRPNPVLRHKLFQVDFLSTLSGEILV
SLLYHKQLDAQWQEEAQALKEALSSKFKVDIIGRARKQKLVMDRDFVIESLPVNGKQLTY
KQVENSFTQPNGEVAIKMLEWAIDITRDSSGDLLELYCGNGNFSIALAQNFNRVLATELA
KPSVDSAQYNIEANQIDNLQIIRMSAEDFTDALAKKRSFRRLEGVDLDSYDCNTIFVDPP
RAGLDDNTLSMVQGYERILYISCNPNTLLDNLKVLDKTHKITRFALFDQFPYTDHMESGV
LLERR