Protein Info for Shew_0134 in Shewanella loihica PV-4

Annotation: tRNA 2-selenouridine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR03167: tRNA 2-selenouridine synthase" amino acids 23 to 353 (331 residues), 353.6 bits, see alignment E=5.3e-110 PF26341: AAA_SelU" amino acids 149 to 369 (221 residues), 293 bits, see alignment E=7.9e-92

Best Hits

Swiss-Prot: 100% identical to SELU_SHELP: tRNA 2-selenouridine/geranyl-2-thiouridine synthase (selU) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 100% identity to slo:Shew_0134)

MetaCyc: 47% identical to tRNA 2-selenouridine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-2281 [EC: 2.9.1.3]

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.- or 2.9.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q958 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Shew_0134 tRNA 2-selenouridine synthase (RefSeq) (Shewanella loihica PV-4)
MDNHQLANVIPASEYGRILASGHPIMDVRAPIEFTKGAFPASSNHPLMRDDERQQVGTCY
KEHGQDAAIALGHSLVCGAVKQQRVDAWLAYLDAHPDAYLYCFRGGLRSQLTQQWLAEAG
RDVPYIQGGYKAMRQYLIDTIDRAPEARPMLILSGITGSGKTDFLLQRQEAVDLEGLAHH
RGSSFGRYHEGQPTQINFENSLGVALLKHQQSPARILLLEDESYLIGRSALPKAFYMGMQ
AASVVILEEPLEARLTRLLDEYVHKMHRGYVERLGEEAGFEAFAEYLANSISGIKKRLGG
KQHDELQQMITDALAVQTQRGDTQAHLEWIALLLSKYYDPMYQYQIGKKADRVIFQGDHQ
AMHQWLDEYATR