Protein Info for Shew_0133 in Shewanella loihica PV-4

Annotation: phospholipid/glycerol acyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 330 to 354 (25 residues), see Phobius details amino acids 366 to 392 (27 residues), see Phobius details amino acids 398 to 416 (19 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 305 (268 residues), 41.1 bits, see alignment E=1.6e-14 PF05977: MFS_3" amino acids 52 to 278 (227 residues), 28 bits, see alignment E=1.2e-10 PF01553: Acyltransferase" amino acids 436 to 564 (129 residues), 96.5 bits, see alignment E=1.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0133)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q957 at UniProt or InterPro

Protein Sequence (620 amino acids)

>Shew_0133 phospholipid/glycerol acyltransferase (RefSeq) (Shewanella loihica PV-4)
MLLTKRFFPYFATQCLGALNDNIYKNVLLLMVTYSQIESLPISVNLFVNLAAGVFILPFF
LFSAHAGVVADNMDKAKLIRRLKQLELVIMSCAAMAILTQSYMMMLLLLFLTGSQSAYFG
PVKYSLLPQALAEDELVTGNAWVEMGTFLSILIGTLSAGLLVASDKGIIATAATVFVLAV
AGYLASRAIPAMPPQGNVTKIRFAPLSGTWRSIAKVRKTPSIWMAILAISWFWFLGATYL
TQFPNFAKLHLHADATVVSLLLALFSIGIAAGSFLCERFSFGHVELGLLPFGVAGLTLFG
VDLLWSLPELPAQAETIYSFSSFIAESQHYRVMFALFMVGVSGGLFIVPLYAFIQSRADR
GECAQAIAANNIMNALFMVVSAVMSILLLEVFGWQITELFLLLALLNAVVALYVYSQVPE
FTQRFVSYLLSHILYRVTVTGRDKLPSEGAGIIVCNHVSYVDALIIMGASTRPIRFVMDK
SISEMPLLKYLFRHAGVIPICSPRQSEATYNQAFESIHQALADGELVCIFPEGRLTPNGE
LGEFRPGIDKILARDSVPVIPMALNGLWGSYFSHKDGHALSTRPKRFWSKISVDLDDVVS
GTEANRHLLRERVEAMLPAS