Protein Info for Shew_0128 in Shewanella loihica PV-4

Annotation: HAD family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 7 to 183 (177 residues), 68.3 bits, E=1.2e-22
• PF13419: HAD_2
  • amino acids 10 to 184 (175 residues), 43.5 bits, E=4.1e-15
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 74 to 185 (112 residues), 46.3 bits, E=2.5e-16

Best Hits

Swiss-Prot: 50% identical to YRFG_SHIFL: GMP/IMP nucleotidase YrfG (yrfG) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to slo:Shew_0128)

MetaCyc: 50% identical to purine nucleotidase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5, 3.1.3.99]; 3.1.3.5 [EC: 3.1.3.5, 3.1.3.99]

Predicted SEED Role

"FIG001957: putative hydrolase"

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• ureide biosynthesis (3/7 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• NAD salvage (plants) (3/11 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.99

Sequence Analysis Tools

See A3Q952 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Shew_0128 HAD family hydrolase (RefSeq) (Shewanella loihica PV-4)
MFPWNKIDTVLLDMDGTLLDLHFDNHFWLSLVPQALCEQRQIPKADAQQLVESAYAKVFG
TLEWYCLEYWQQELGLDILALHHTLVDRIQLRQDSMPFLTALARHSKRRILVTNAHPHSL
ALKLEHTDLANGLDEMLSSHATGYPKEHPQFWRHLFNQYSLDPSRCLFIDDSEPILQAAK
KAGVGYQLGIKNPDSQQPHKQFADFPAIDDYHHLLLSLEQARLG